PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3B_FA3CD3CB6.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YB
Protein Properties Length: 400aa    MW: 43310 Da    PI: 9.5142
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3B_FA3CD3CB6.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB67.72.1e-21115197385
                 NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 
                           ++d  lP + +++i+k++lP + ++++d+++++ ec +efi +++se++d c r+++kti+++ ++ al +lGf++yve++ +
  Traes_3B_FA3CD3CB6.1 115 KEDVSLPKSTMTKIIKEMLPPDVRVARDTQDLLVECCVEFINLLSSESNDVCSRDDKKTIAPEHVIRALQDLGFKEYVEEVYA 197
                           67999**************************************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-36112244IPR009072Histone-fold
SuperFamilySSF471131.62E-33116244IPR009072Histone-fold
PfamPF008085.8E-18119183IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MYSKLFHRQK KTVQYMGRGL ATWAGPVGGR SVRVGANLTQ RAPRRPARLT LTLATIPFCN  60
PVVSQGASPK AKPSLPSSAR THRSRRDAPS APQAQAPSRA RRRGMDPMDI VGKSKEDVSL  120
PKSTMTKIIK EMLPPDVRVA RDTQDLLVEC CVEFINLLSS ESNDVCSRDD KKTIAPEHVI  180
RALQDLGFKE YVEEVYAAYE QHKLETLDSP KATKFTGIEM TEEEAVAEQQ RMFAEARARM  240
NNGAAKPKEP ALEPQNQPQQ PPQPQLQLHP QAQQPPQPQS QLHHPQSQQP LHPQLQPYTQ  300
APPQQPLHPQ LQPYTQAPPQ QPLQPPLQLY PQAQPEQPLQ PQSSGSTTGT CVISTAAPST  360
TGTTAAATAA PAIPAISTAA PSATPADASA AAAATSTPAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B2e-3111423710133Transcription Regulator NC2 beta chain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0092340.0BT009234.1 Triticum aestivum clone wle1n.pk0106.g11:fis, full insert mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235094.11e-119PREDICTED: nuclear transcription factor Y subunit beta-like
TrEMBLW5DCE80.0W5DCE8_WHEAT; Uncharacterized protein
STRINGBRADI3G34930.11e-118(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57203549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.41e-70nuclear factor Y, subunit B13